LJive.com

Website information and statistics

 
Loading...

Server IP address list based on C block (109.232.x.x)

For a website to be accessible on the internet, it needs to be hosted on a certain server with an IP address. This page contains the list of the said IP addresses. Each server IP is hosting one domain at least, but sometimes quite a bit more than that.

To make the list easier to navigate, we've devided it into A,B,C,D block IP addresses. This list contains A block IP addresses. The Child IP section of the table below lists IP addresses that share A block. Hosted domains sections lists domains that are hosted on that IP address.

Loading...
C block IPDescendant IPHosted websites
109.232.225.x
  1. 109.232.225.37
  2. 109.232.225.16
  3. 109.232.225.52
  4. 109.232.225.46
  5. 109.232.225.39
  6. 109.232.225.34
  7. 109.232.225.32
  8. 109.232.225.31
  9. 109.232.225.25
  1. likewith.me
  2. talkandtalkers.us
  3. hackathonbd.com
  4. androidphonebuzz.com
  5. bjornaresolstad.com
  6. bombpoker.com
  7. lvpshosting.com
  8. emannabih.com
  9. mattsports.co.uk
  10. youtubebot.org
  11. starinjob.com
  12. pregnancytrackerapp.com
  13. sheazone.com
  14. selfcoloringpages.com
  15. shophouseholdappliance.com
109.232.33.x
  1. 109.232.33.203
  1. to-dis.it
109.232.177.x
  1. 109.232.177.20
  1. hpicheck.com
109.232.226.x
  1. 109.232.226.83
  2. 109.232.226.85
  3. 109.232.226.228
  4. 109.232.226.213
  5. 109.232.226.148
  1. friezelen.com
  2. audiko.fr
  3. audiko.net
  4. audiko.tw
  5. loetje.com
  6. opel-forum.nl
  7. audiko.com
  8. rys.nl
  9. audiko.pl
  10. audiko.ru
109.232.221.x
  1. 109.232.221.143
  2. 109.232.221.156
  3. 109.232.221.152
  4. 109.232.221.99
  5. 109.232.221.98
  6. 109.232.221.97
  7. 109.232.221.96
  8. 109.232.221.88
  9. 109.232.221.86
  10. 109.232.221.6
  11. 109.232.221.42
  12. 109.232.221.37
  13. 109.232.221.32
  14. 109.232.221.31
  15. 109.232.221.252
  16. 109.232.221.242
  17. 109.232.221.22
  18. 109.232.221.210
  19. 109.232.221.197
  20. 109.232.221.187
  21. 109.232.221.179
  22. 109.232.221.172
  23. 109.232.221.162
  24. 109.232.221.159
  25. 109.232.221.158
  26. 109.232.221.157
  27. 109.232.221.154
  28. 109.232.221.141
  29. 109.232.221.139
  30. 109.232.221.138
  31. 109.232.221.137
  32. 109.232.221.130
  33. 109.232.221.118
  34. 109.232.221.114
  35. 109.232.221.11
  36. 109.232.221.101
  1. robotpark.com
  2. ozgunes.com.tr
  3. avrupatedarik.com
  4. sporbox.com.tr
  5. iskur.us
  6. refturf.com
  7. mebajans.net
  8. hemenelimde.com
  9. merhabayozgat.com
  10. developerkafasi.com
  11. etkinlik.com.tr
  12. yumurtasunger.org
  13. sarkisozleri.bbs.tr
  14. goalgrass.com
  15. akustiksunger.net
  16. reformgroup.com.tr
  17. samsununhaberi.com
  18. nusellus.com.tr
  19. arma-tek.com
  20. karabuknethaber.com
  21. aylinsatunolsun.com
  22. sportesisleri.com
  23. mcpsp.com
  24. kuup.com
  25. halibul.com
  26. reformsports.com
  27. limakhotels.com
  28. oyuneditoru.net
  29. muscleandfitness.com.tr
  30. mcps4.com
  31. bulsam.net
  32. ciftcizade.com
  33. nirvanahotel.com
  34. bonalodi.com
  35. starstil.ru
  36. dunyalilar.org
  37. sesyalitimsungerleri.com
  38. haberportalim.net
  39. hepsibizde.com.tr
  40. listefilm.com
  41. aydinbeyhotels.com.tr
  42. radarex.com
  43. turuncukasa.com
  44. mebingilizce.net
  45. armaganportakal.com
109.232.238.x
  1. 109.232.238.47
  1. la4ldesylvie.fr
109.232.170.x
  1. 109.232.170.185
  1. tine20.com
  2. tine20.org
109.232.32.x
  1. 109.232.32.88
  2. 109.232.32.30
  3. 109.232.32.26
  4. 109.232.32.228
  5. 109.232.32.111
  1. vivigas.it
  2. spagobi.org
  3. spagoworld.org
  4. unar.it
  5. eng.it
  6. fiamm.com
109.232.172.x
  1. 109.232.172.90
  2. 109.232.172.89
  3. 109.232.172.85
  4. 109.232.172.125
  5. 109.232.172.122
  6. 109.232.172.118
  7. 109.232.172.117
  1. oepnvaktuell.de
  2. thb.info
  3. travel-one.net
  4. intergerma.de
  5. railwaygazette.com
  6. eurailpress.de
  7. schiffundhafen.de
  8. dvz.de
109.232.173.x
  1. 109.232.173.207
  2. 109.232.173.158
  1. sartorius.de
  2. sartorius.us
  3. sartorius.com
  4. diia.de
109.232.88.x
  1. 109.232.88.25
  1. gemini-alarm.com
109.232.224.x
  1. 109.232.224.82
  2. 109.232.224.74
  3. 109.232.224.73
  4. 109.232.224.43
  5. 109.232.224.4
  6. 109.232.224.35
  7. 109.232.224.237
  8. 109.232.224.113
  1. pizzaplus.dk
  2. gameforfree.eu
  3. 24x7h.com
  4. actorespr.com
  5. serverboost.com
  6. sneakereshop.com
  7. nastyarai.ru
  8. powerwatch.pw
109.232.43.x
  1. 109.232.43.100
  1. drmobile.eu
109.232.223.x
  1. 109.232.223.83
  2. 109.232.223.190
  3. 109.232.223.155
  4. 109.232.223.147
  5. 109.232.223.11
  1. simkupabardak.com
  2. leventuysal.com
  3. cez.io
  4. cezmikalorifer.com
  5. tekkocaeli.com
  6. yds.net
  7. nisantasi.edu.tr
  8. akindil.com
  9. kpds.org
109.232.251.x
  1. 109.232.251.253
  1. ibank2.ru
109.232.144.x
  1. 109.232.144.195
  1. metae.ru
109.232.207.x
  1. 109.232.207.254
  1. pecsinapilap.hu
109.232.176.x
  1. 109.232.176.164
  1. instantcarcheck.co.uk
109.232.218.x
  1. 109.232.218.55
  2. 109.232.218.99
  3. 109.232.218.48
  4. 109.232.218.43
  5. 109.232.218.28
  6. 109.232.218.27
  7. 109.232.218.242
  8. 109.232.218.24
  9. 109.232.218.231
  10. 109.232.218.224
  11. 109.232.218.209
  12. 109.232.218.172
  13. 109.232.218.171
  14. 109.232.218.16
  15. 109.232.218.15
  16. 109.232.218.130
  17. 109.232.218.125
  18. 109.232.218.124
  19. 109.232.218.113
  20. 109.232.218.105
  1. dentaluna.com
  2. kitapdenizi.com
  3. sanatblog.com
  4. opencart-temalari.com
  5. selimakyuz.com
  6. makyajgunlugu.com
  7. clinicana.com
  8. cezasorgulama.net
  9. japontrend.com
  10. kabalci.com.tr
  11. saataksesuar.com
  12. tasarimsensin.com
  13. timurdemir.com.tr
  14. erkansaka.net
  15. otomovi.com
  16. birool.com
  17. asdteknoloji.net
  18. yilkomer.com
  19. ensarhac.com
  20. poyrazkoykadinlarplaji.com
  21. opencart-themes.org
109.232.222.x
  1. 109.232.222.236
  2. 109.232.222.77
  3. 109.232.222.47
  4. 109.232.222.33
  5. 109.232.222.69
  6. 109.232.222.140
  7. 109.232.222.39
  8. 109.232.222.25
  9. 109.232.222.51
  10. 109.232.222.32
  11. 109.232.222.151
  12. 109.232.222.150
  13. 109.232.222.38
  14. 109.232.222.88
  15. 109.232.222.80
  16. 109.232.222.79
  17. 109.232.222.6
  18. 109.232.222.5
  19. 109.232.222.43
  20. 109.232.222.4
  21. 109.232.222.31
  22. 109.232.222.3
  23. 109.232.222.26
  24. 109.232.222.227
  25. 109.232.222.206
  26. 109.232.222.201
  27. 109.232.222.194
  28. 109.232.222.187
  29. 109.232.222.186
  30. 109.232.222.180
  31. 109.232.222.174
  32. 109.232.222.169
  33. 109.232.222.168
  34. 109.232.222.121
  35. 109.232.222.120
  36. 109.232.222.12
  37. 109.232.222.107
  38. 109.232.222.10
  1. elsanatlariburada.com
  2. toptanci41.com
  3. afolog.com
  4. message34.com
  5. dizimeraki.com
  6. orduca.com
  7. birinciblok.com
  8. ordutimes.com
  9. anlikbirikimlerintoplami.com
  10. radarex.com
  11. polotuning.net
  12. japonca.com.tr
  13. medifema.com.tr
  14. fatihkitap.com
  15. dokuzyazilim.com
  16. upperness.com
  17. projehocam.com
  18. fitsolutions.com.tr
  19. ilknokta.com
  20. nigde.bel.tr
  21. webduzzi.com
  22. saciniboya.com
  23. legalkitabevi.com
  24. herseyhediye.com
  25. kitapperver.com
  26. ordusonhaber.com
  27. ciftcinizden.com
  28. ordumedya.com
  29. dogaldekor.com
  30. modacriseshop.com
  31. powerbank.gen.tr
  32. tirtilgencodasi.com
  33. dekorelle.com.tr
  34. ordumm.com
  35. scooterayakkabi.com
  36. vikva.net
  37. burhankitap.com
  38. kitapvekitap.com
  39. ucuzofisim.com
109.232.242.x
  1. 109.232.242.161
  2. 109.232.242.151
  3. 109.232.242.68
  4. 109.232.242.6
  1. multiwypoczynek.pl
  2. benefitsystems.pl
  3. multibenefit.pl
  4. kartasportowa.pl
109.232.104.x
  1. 109.232.104.109
  1. fa.ru
  2. ufrf.ru
109.232.219.x
  1. 109.232.219.117
  2. 109.232.219.188
  3. 109.232.219.192
  4. 109.232.219.173
  5. 109.232.219.64
  6. 109.232.219.45
  7. 109.232.219.38
  8. 109.232.219.37
  9. 109.232.219.33
  10. 109.232.219.250
  11. 109.232.219.209
  12. 109.232.219.185
  13. 109.232.219.137
  1. cropmobilya.com
  2. igd.com.tr
  3. besensilver.com
  4. kutsaldinislam.com
  5. gunlukkahve.com
  6. bianchi.com.tr
  7. akillitelefonlar.com
  8. erdemarslan.com
  9. ersoytoptas.com.tr
  10. ladivasabun.com
  11. accellbisiklet.com.tr
  12. videmy.com
  13. magaza24.com
109.232.220.x
  1. 109.232.220.65
  2. 109.232.220.56
  3. 109.232.220.54
  4. 109.232.220.47
  5. 109.232.220.44
  6. 109.232.220.40
  7. 109.232.220.39
  8. 109.232.220.37
  9. 109.232.220.29
  10. 109.232.220.253
  11. 109.232.220.252
  12. 109.232.220.251
  13. 109.232.220.25
  14. 109.232.220.249
  15. 109.232.220.248
  16. 109.232.220.235
  17. 109.232.220.234
  18. 109.232.220.233
  19. 109.232.220.231
  20. 109.232.220.23
  21. 109.232.220.228
  22. 109.232.220.227
  23. 109.232.220.220
  24. 109.232.220.22
  25. 109.232.220.218
  26. 109.232.220.216
  27. 109.232.220.215
  28. 109.232.220.214
  29. 109.232.220.21
  30. 109.232.220.202
  31. 109.232.220.201
  32. 109.232.220.16
  1. kozahaber.net
  2. otobusbankasi.com
  3. halkboyleistiyor.com
  4. crystalhotelsblog.com
  5. komiksler.com
  6. sexo5.com
  7. ulakofis.com
  8. limnofish.org
  9. makaleisi.com
  10. onairadio.net
  11. oyunskor.red
  12. coloringpagess.com
  13. ismailcakir.net
  14. serapersoy.com
  15. ozgurwebtasarim.com
  16. anadolukenthaber.com
  17. utilcheat.com
  18. oyunskorx.com
  19. saglikdanis.com
  20. baskentkariyer.com
  21. komikli.net
  22. gazetetirajlari.com
  23. fatihsayin.com
  24. ybhaber.com
  25. alarahotels.com
  26. webmasterkurdu.com
  27. bloglug.com
  28. ko-tr.net
  29. woodyville.com.tr
  30. mymemur.com
  31. arabasat.com.tr
  32. enucuzhizmet.com
  33. sporhobim.com
  34. mevese.com
  35. pouoyna.com
  36. ogghaber.net
  37. grafiking.com
  38. ilkseo.com
  39. evhanimlarindanyemektarifleri.com
  40. thyva.com
  41. anadoluhaberim.com
  42. jeansgurulari.com
  43. hukukevi.net
  44. reformpackagingmachine.com
  45. yilmazarslanturk.com
  46. aymoli.com
  47. chalilozdemir.com
  48. modaruzgari.org
  49. bilgininanahtari.net
  50. filmyeriniz.com
  51. oyungt.com
109.232.208.x
  1. 109.232.208.203
  1. tmdn.org
109.232.200.x
  1. 109.232.200.51
  1. entity.hu
109.232.217.x
  1. 109.232.217.138
  2. 109.232.217.103
  3. 109.232.217.195
  4. 109.232.217.207
  5. 109.232.217.188
  6. 109.232.217.9
  7. 109.232.217.137
  8. 109.232.217.198
  9. 109.232.217.22
  10. 109.232.217.18
  11. 109.232.217.25
  12. 109.232.217.153
  13. 109.232.217.131
  14. 109.232.217.15
  15. 109.232.217.200
  16. 109.232.217.98
  17. 109.232.217.94
  18. 109.232.217.92
  19. 109.232.217.91
  20. 109.232.217.89
  21. 109.232.217.86
  22. 109.232.217.82
  23. 109.232.217.81
  24. 109.232.217.74
  25. 109.232.217.72
  26. 109.232.217.71
  27. 109.232.217.70
  28. 109.232.217.67
  29. 109.232.217.66
  30. 109.232.217.60
  31. 109.232.217.58
  32. 109.232.217.55
  33. 109.232.217.53
  34. 109.232.217.51
  35. 109.232.217.49
  36. 109.232.217.47
  37. 109.232.217.46
  38. 109.232.217.45
  39. 109.232.217.44
  40. 109.232.217.43
  41. 109.232.217.40
  42. 109.232.217.39
  43. 109.232.217.38
  44. 109.232.217.37
  45. 109.232.217.36
  46. 109.232.217.32
  47. 109.232.217.30
  48. 109.232.217.28
  49. 109.232.217.27
  50. 109.232.217.26
  1. hobistil.com
  2. oib.gov.tr
  3. esmaulhusna.info
  4. takitasarimlarim.com
  5. sevgiplatformu.info
  6. alofatih.com
  7. k-ma.com.tr
  8. salihemreuregen.com
  9. solyayin.com
  10. bilici.net
  11. lotussanat.com
  12. fxevi.com
  13. sabahkemalcansu.com
  14. galerisoyut.com.tr
  15. mertcaneyriyer.com
  16. devdevlet.com
  17. haber228.com
  18. dakika.org
  19. oyunhafizasi.com
  20. egitimmevzuat.com
  21. blogdanasilyapilir.com
  22. telefonkiliflari.com
  23. enguzeltesettur.com
  24. zenn.com.tr
  25. bayanin.com
  26. mathfgames.com
  27. valsmuzikdans.com
  28. delipoyraz.net
  29. aristotheme.com
  30. cagridestek.com
  31. sabrinashaus.com
  32. personelelemanalimlari.com
  33. sosyalprestij.com
  34. farukakhan.com
  35. mobilyayatak.com
  36. makerhareketi.com
  37. ucanfil.com
  38. hediyetavsiyesi.com
  39. telefonaksesuarlari.com
  40. teknolojidolabi.com
  41. selcukhaber.com
  42. silahdarav.com
  43. elizabethtrend.com
  44. setup34.com.tr
  45. swordvision.ru
  46. yaliemlak.com.tr
  47. belgun.tv
  48. goproturkiye.com
  49. yirtikharita.com
  50. kadinlive.com
  51. retricaindir.net
109.232.107.x
  1. 109.232.107.160
  1. 1000melo.ru
109.232.171.x
  1. 109.232.171.1
  1. bijou-brigitte.com
  2. bijou-brigitte.it
109.232.187.x
  1. 109.232.187.187
  2. 109.232.187.154
  1. pskgu.ru
  2. luxury-mall.ru
109.232.227.x
  1. 109.232.227.30
  2. 109.232.227.101
  3. 109.232.227.98
  4. 109.232.227.102
  5. 109.232.227.100
  6. 109.232.227.52
  7. 109.232.227.29
  8. 109.232.227.153
  1. sexymomspictures.com
  2. dailyexgirlfriends.com
  3. divineselfshots.com
  4. hindimob.com
  5. asianpornpicture.com
  6. 1bbwporn.com
  7. teenbigasses.com
  8. hardasianporn.com
  9. asian-sexy.com
  10. velatarparivarsardhav.org
  11. anzac.co.in
  12. tamilmob.com
  13. divineteengirls.com
  14. nakedteenasian.com
  15. paasnews.com
  16. bigboobsnudepics.com
  17. hondaarabia.com
  18. spidermangamescollection.com
  19. asiansexyteen.com
  20. bigboobsasian.com
  21. divinetighties.com
  22. asiansgirl.com
  23. youngselfshots.com
  24. sexyteengfs.com
  25. divinegirlfriends.com
  26. innocentexgfs.com
  27. dailyexgfphotos.com
  28. freesexyasian.com
  29. asianbuttspics.com
  30. desigujju.com
  31. hotasiantits.com
  32. youngteengfs.com
  33. youngexgirlfriends.com
  34. m7shsh.com
  35. asiansbooty.com
  36. asianbabepics.com
  37. m7girlsgames.com
109.232.44.x
  1. 109.232.44.186
  2. 109.232.44.185
  1. destaffinggroep.nl
  2. it-staffing.nl
109.232.216.x
  1. 109.232.216.98
  2. 109.232.216.203
  3. 109.232.216.33
  4. 109.232.216.102
  5. 109.232.216.250
  6. 109.232.216.208
  7. 109.232.216.117
  8. 109.232.216.212
  9. 109.232.216.134
  10. 109.232.216.238
  11. 109.232.216.201
  12. 109.232.216.249
  13. 109.232.216.251
  14. 109.232.216.150
  15. 109.232.216.207
  16. 109.232.216.174
  17. 109.232.216.99
  18. 109.232.216.94
  19. 109.232.216.91
  20. 109.232.216.9
  21. 109.232.216.89
  22. 109.232.216.88
  23. 109.232.216.86
  24. 109.232.216.85
  25. 109.232.216.84
  26. 109.232.216.82
  27. 109.232.216.81
  28. 109.232.216.79
  29. 109.232.216.75
  30. 109.232.216.74
  31. 109.232.216.72
  32. 109.232.216.71
  33. 109.232.216.70
  34. 109.232.216.66
  35. 109.232.216.61
  36. 109.232.216.59
  37. 109.232.216.58
  38. 109.232.216.56
  39. 109.232.216.54
  40. 109.232.216.52
  41. 109.232.216.51
  42. 109.232.216.49
  43. 109.232.216.45
  44. 109.232.216.44
  45. 109.232.216.42
  46. 109.232.216.40
  47. 109.232.216.30
  48. 109.232.216.28
  49. 109.232.216.27
  50. 109.232.216.253
  1. ulit.org
  2. siriusufo.org
  3. wmaraclari.net
  4. ndesign.com.tr
  5. mehmetakifguvenen.com.tr
  6. taraf04.net
  7. esenyurthaberleri.com
  8. motosikletradyo.com
  9. sacforum.com
  10. osertok.com
  11. alibey.com
  12. acarlaw.com
  13. beratbalki.com
  14. uzmanseo.net
  15. bilgihanesi.com
  16. futbolmedya.com
  17. kadinneder.com
  18. yakamozyakut.com.tr
  19. tikhaber.com
  20. rcpano.net
  21. gezginlerkulubu.org
  22. farukakhan.com
  23. pinner.com.tr
  24. alovizem.com
  25. dogrutercih.com
  26. uzakdogumalzemeleri.com
  27. muraterdor.com
  28. shopphp.net
  29. alimvar.com
  30. effect.com.tr
  31. asroyal.net
  32. maroon.com.tr
  33. unlu.co
  34. arduinoturkiye.com
  35. oyascuisine.com
  36. endersarac.com.tr
  37. saglikpersonelininsesi.com
  38. escblog.net
  39. jagclub.com.tr
  40. egeninhaberi.com
  41. gezgindergi.com
  42. eminebeder.com
  43. na-de.com.tr
  44. pdfdergi.com
  45. yeltenkasabasi.com
  46. curiotravel.com
  47. analizhaberajansi.com
  48. muhasebeciyorumluyor.com
  49. baskentiletisim.com
  50. sosyalcalisma.com
109.232.231.x
  1. 109.232.231.42
  1. bobbejaanland.eu
109.232.105.x
  1. 109.232.105.78
  2. 109.232.105.75
  3. 109.232.105.187
  1. italy-vms.kz
  2. italy-vms.com.ua
  3. italyvms.ru
  4. italy-vms.ru
  5. visametric.az
  6. russianhighways.ru
  7. italyvms.com.ua
109.232.121.x
  1. 109.232.121.116
  2. 109.232.121.139
  3. 109.232.121.121
  4. 109.232.121.118
  1. comline-shop.de
  2. insel-sylt.de
  3. flughafen-sylt.de
  4. nordclick.de
6