A quick breakdown about the Modernfamilynightlysweepstakes.com website can be found further down:
Aspect | Summary |
---|---|
Website load speed: | 0.6211s this is quite good! |
Number of (outgoing) links: | 7 |
HTML size: | 3.2 kilobytes Good |
meta-tag og:description | Enter for a chance to win a trip to Hollywood, California, and attend a Modern Family table read! |
meta-tag og:title | Modern Family Hollywood Here I Come Sweepstakes |
meta-tag og:url | http://www.modernfamilynightlysweepstakes.com |
meta-tag og:image | http://www.modernfamilynightlysweepstakes.com/images/fb-share-icon-national.jpg |
HTTP/1.1 200 OK Server: Microsoft-IIS/8.5 X-AspNet-Version: 4.0.30319 Cache-Control: private Content-Type: text/html; charset=utf-8 Date: Thu, 28 Jul 2016 10:19:17 GMT Set-Cookie: X-Mapping-ggleffgg=66B46BF0ED21D8CD001F8AC3574F5199; path=/ X-Powered-By: ASP.NET Content-Length: 3231
The following domains are, too, hosted on 174.143.163.233:
Website address | IP in detail |
---|---|
174.143.163.233 174.143.163.233 |
Strangely, no meta keywords are used by the website Modernfamilynightlysweepstakes.com.
Based on A and B block, the following IP adresses are similar to 174.143.163.233
The following domain extensions are available for the domain name, with a total of 730 variations available:
As mentioned by Alexa on their official page, the Alexa rank or rating is calculated using a number of different parameters, such as daily average of unique visitors as well as pageviews over the last three months. The more unique visitors and pageviews, the higher the overall rank.
Lowest rating: | 841,248 spotted 3,196 days ago |
---|---|
Current rating: | 342,938 spotted 3,147 days ago |
Best rating: | 88,089 spotted 3,170 days ago |
Average rating: | 183,031 |
Visitors frequently mistype modernfamilynightlysweepstakes.com.
Here is a list of most common misspellings:
It seems modernfamilynightlysweepstakes.com has only been registered once and was never abandoned or has never expired.
Established in 2006, the technology company Quantcast provides audience measurements and an opportunity for advertising in real time. In addition to that, the American company ensures public access to all sorts of website-related data (traffic and demographic) for millions of websites, as well as in-depth user insights to digital bloggers and publishers enrolled in Quantcast's Quantified Publisher Program. The processing capability provided by Quantcast is impressive – over 800 thousand transactions per second, with, as claimed by the company, accurate audience calculation for over 100 million online destinations. In 2013, Quantcast was widely believed to be among the top five of world's largest data processing companies. Holding offices in London, Dublin, New York and Chicago, the main headquarters of Quantcast is in San Francisco, CA.
Unfortunately, our database contains no Quantcast rank data for Modernfamilynightlysweepstakes.com at this time.
Other lists the domain modernfamilynightlysweepstakes.com appears in are: